Protein Info for PFR28_04822 in Pseudomonas sp. RS175

Annotation: Multidrug resistance protein MdtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 32 to 349 (318 residues), 240.3 bits, see alignment E=1.3e-75 PF16576: HlyD_D23" amino acids 51 to 263 (213 residues), 55.2 bits, see alignment E=9.5e-19 PF13533: Biotin_lipoyl_2" amino acids 56 to 102 (47 residues), 42.7 bits, see alignment 5.7e-15 PF13437: HlyD_3" amino acids 169 to 265 (97 residues), 37.8 bits, see alignment E=4.2e-13

Best Hits

KEGG orthology group: None (inferred from 94% identity to pba:PSEBR_a238)

Predicted SEED Role

"Efflux membrane fusion protein, RND family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>PFR28_04822 Multidrug resistance protein MdtA (Pseudomonas sp. RS175)
MKRLWMVLAGLALAACSKEEAPPEPVRPVLSIEVRALDQQALGRFAGNIQARYESNVGFR
VAGRIARRNVDVGAEVKKGDLLATLDPTDQQNQLRAAQGDLARIEAQYINAQANARRQQQ
LFDRGVGAQAQLDIAQTDLKTTGASLEQARAAVEQARDQLNYSELRTDHDAVVTAWHAEA
GQVVTAGQQVVTLARPDIKEAVIDLPAGLAERLPPDVVFEVSAQLDPATRTTATVREIEP
QAQSATRTRRARLTLADTPPGLRLGTAIGVTLSSAIEPRIELPLSALQEVDGKARIWLVD
PQSQTVSPRDVRILERSADVVLVANGIKAGDRVVSAGVNSLQPGQKVKLDEDAR