Protein Info for PFR28_02120 in Pseudomonas sp. RS175

Annotation: Outer membrane protein TolC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02321: OEP" amino acids 26 to 216 (191 residues), 73.7 bits, see alignment E=8.8e-25 amino acids 244 to 428 (185 residues), 101.2 bits, see alignment E=3.3e-33 TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 27 to 442 (416 residues), 389.3 bits, see alignment E=1.2e-120

Best Hits

Swiss-Prot: 55% identical to APRF_PSEAE: Alkaline protease secretion protein AprF (aprF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 93% identity to pba:PSEBR_a2825)

Predicted SEED Role

"ABC-type protease exporter, outer membrane component PrtF/AprF" in subsystem Protein secretion by ABC-type exporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>PFR28_02120 Outer membrane protein TolC (Pseudomonas sp. RS175)
MKYFQWLAVLAVSACGNVWAMGPFEIYEQALRNDPVYLGAVKERDAGLENRAIGRAGLLP
HLGYSYNKGRNRSKVTYLNDHGASQHDNRNYSSYGSSLTLQQPLLDYEAYAAYRKGVAQA
LFADENFRSKSQELLVRVLSHYTQALFAQDQIDIAQAKKRAFEQQFRQNEHMFRQGEGTR
TDILEAESRYELAIAEEIEARDEQDAALRELGALIGVPALDIGDLAPLNETFQVFTLQPA
SFDSWHGLAVSNNPTLASQRQAVDVARFEVERNRAGHLPTISAYATMRQNESESGNTYNQ
RYDTNTIGLEVSVPLYAGGGVSASTRQASRNMEQAEYELDAKTRETLIELRRQFSACVSG
ANKLRAYQKALSSAEALVVSTRQSILGGERVNLDALNAEQQLYTTRRDLAEARYDYLMAW
TKLHYYAGTLGEQDLAKVDEAFVTRGQ