Protein Info for PFR28_02030 in Pseudomonas sp. RS175

Annotation: Riboflavin transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 138 to 155 (18 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 251 to 268 (18 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details PF00892: EamA" amino acids 19 to 152 (134 residues), 49.3 bits, see alignment E=2.8e-17 amino acids 164 to 286 (123 residues), 43.2 bits, see alignment E=2.2e-15

Best Hits

KEGG orthology group: None (inferred from 74% identity to pba:PSEBR_a3622)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>PFR28_02030 Riboflavin transporter (Pseudomonas sp. RS175)
MSDPMERIPLAQQVPRPQLGIVLCLLSMMIFAFQDAITKVMVRDLPVTQLVMVRYWAFLA
FAIVYSLCKGGLRAASRTRHPYLQVIRALIGIGEIALFGIGLRYLGLAQTHALFAVFPLM
TLALAGIFLKEFVGIRRWLAAAVGFAGTLVILRPGSGVFELAALIPLIAALCFAVFNVLT
RRISQGDAFATNMLYMGLVGAAAITLVGFPGWVAPNPLQWALLGVLSITGVVAQLLLFQA
LRYATASTLQPFNYTLLVFATLIGLLFFGELPDIWTVTGGCMVIAAGLYAARVAR