Protein Info for PFR28_00974 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 7 to 37 (31 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 136 to 160 (25 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details PF01925: TauE" amino acids 8 to 244 (237 residues), 159.7 bits, see alignment E=5e-51

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 89% identity to pba:PSEBR_a1619)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>PFR28_00974 hypothetical protein (Pseudomonas sp. RS175)
MIESFLYLVVGAALGTLGGLFGIGGGLIAIPVLGVWFGLDQQIAQGTALVMVVPNVMLAL
WRYHQRNRIELRHVLPLATMGFCFAWLGSIWAVGIDAQSMRIGFVAFLIVLAAYNLIRMF
ATSAPASAQMRYGWPWLGVLGAVSGAMGGLFGVGGAVVATPILTSLFGTTQVVAQGLSLS
LALPSTGVTLATYAFHHQVDWSIGVPLAAGGLLSISWGVKVAHAMPERLLRALFCGFLVV
CAILLAFKA