Protein Info for PFR28_00300 in Pseudomonas sp. RS175

Annotation: Outer membrane protein assembly factor BamB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR03300: outer membrane assembly lipoprotein YfgL" amino acids 5 to 377 (373 residues), 441.7 bits, see alignment E=8.8e-137 PF01011: PQQ" amino acids 67 to 101 (35 residues), 22.3 bits, see alignment 1.3e-08 amino acids 108 to 143 (36 residues), 29.3 bits, see alignment 7.7e-11 amino acids 243 to 272 (30 residues), 25.5 bits, see alignment (E = 1.2e-09) PF13360: PQQ_2" amino acids 76 to 306 (231 residues), 180.4 bits, see alignment E=6.7e-57 amino acids 289 to 378 (90 residues), 23.2 bits, see alignment E=7.3e-09 PF13570: PQQ_3" amino acids 86 to 125 (40 residues), 22.1 bits, see alignment 2.5e-08 amino acids 126 to 165 (40 residues), 33.5 bits, see alignment 6.2e-12 amino acids 234 to 261 (28 residues), 22.6 bits, see alignment (E = 1.7e-08)

Best Hits

Swiss-Prot: 73% identical to BAMB_PSEAE: Outer membrane protein assembly factor BamB (bamB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a939)

Predicted SEED Role

"Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>PFR28_00300 Outer membrane protein assembly factor BamB (Pseudomonas sp. RS175)
MIQWKHAALLALAILAAGCSSNSKKELPPAELTDFKEEVVLQKQWSRSIGDGQGETYNML
VPAIDGDTIYAGDVTGVVMAMDRMNGDVKWEKDLELPVSGAVGVGYGLVMIGTLKGEIVA
LDASSGEEKWRARVTSEVLAPPATNGDVVVVQTQDDRLIGLDAATGSQRWLYDSTPAVLT
LRGTSAPIVTNRLAVAGLSTGKVVALDVSNGVPVWEQRVAIPQGRSELERVVDIDGGLLL
SGGTLYVASYQGRVAALDLETGRPLWQRDASSYAGVAQGFGSVYVSLASGTVEGVDERST
TALWSNDSLARRQLSAPEVFSSYVAVGDLEGYLHLLSQVDGRFVGRERIDSDGLRARPLV
VGSMIYVYGNSGKLEALTIK