Protein Info for PFLU_RS29555 in Pseudomonas fluorescens SBW25

Annotation: HDOD domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 253 to 273 (21 residues), see Phobius details amino acids 316 to 336 (21 residues), see Phobius details PF04073: tRNA_edit" amino acids 29 to 140 (112 residues), 42.9 bits, see alignment E=4.8e-15 PF08668: HDOD" amino acids 194 to 394 (201 residues), 156.4 bits, see alignment E=6.8e-50

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU6004)

Predicted SEED Role

"Predicted signal transduction protein" in subsystem Flagellar motility

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K492 at UniProt or InterPro

Protein Sequence (466 amino acids)

>PFLU_RS29555 HDOD domain-containing protein (Pseudomonas fluorescens SBW25)
MSEVALATAPLTAPPVIRALLAKLAIPYTEVADLPGLNPARKVQAVLLEDAVGALMVLFP
QNQLLDLNRLTELTGRRLIAVSPERVARMLGKHDLSLLPGLPPLTSSPCLYEGSLLNEPN
LLVHSGEAGLLLEIASDDFKTMLTKASAAQFGEPLSNIRPNLDRPNDDREEITQAMQAFT
ARRIQQRLEATIEIPPLADTAQKIIKLRVDPNATIDDITGVVETDPSLAAQVVSWAASPY
YASPGKIRSVEDAIVRVLGFDLVINLALGLALGKTLSLPKDHPHQATPYWHQSIYTAAVI
EGLTRAMPRAQRPEAGLTYLAGLLHNFGYLLLAHVFPPHFSLICRHLEVNPHLCHSYVEQ
HLLGISREQIGAWLMRYWDMPDELSTALRFQHDPTYDGQYAEYPNLVCLAVRLLRSRGIG
SGPDEAIPDALLERLGLSRDKAEEVVGKVLDAEVLLRELASQFSQG