Protein Info for PFLU_RS27640 in Pseudomonas fluorescens SBW25

Annotation: alpha/beta fold hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF12697: Abhydrolase_6" amino acids 5 to 231 (227 residues), 36.7 bits, see alignment E=7.3e-13 PF00561: Abhydrolase_1" amino acids 47 to 226 (180 residues), 37.6 bits, see alignment E=2.1e-13

Best Hits

Swiss-Prot: 35% identical to BIOH_AROAE: Pimeloyl-[acyl-carrier protein] methyl ester esterase (bioH) from Aromatoleum aromaticum (strain EbN1)

KEGG orthology group: K02170, biotin biosynthesis protein BioH (inferred from 100% identity to pfs:PFLU5613)

Predicted SEED Role

"Biotin synthesis protein BioH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K362 at UniProt or InterPro

Protein Sequence (243 amino acids)

>PFLU_RS27640 alpha/beta fold hydrolase (Pseudomonas fluorescens SBW25)
MRDRLVLLPGWGLGVSPLEPLAAALQGLDEHLQVHIEPLPALGSSDLNEWLDELDATLPD
NAWLGGWSLGGMLASELAARRGERCCGLLTLASNPCFVAHDAWPSAMPAETFDAFLAGCH
ADSQVTLKRFGLLCAKGAEDPRGLSRLLVSGAPNTPSSVLMPGLELLAQLDTREALLAYR
GPQLHLFAGLDGLVPAEAASDLLALLPDVEIGLIEQAGHAFLLEDPHGVAGAIQAFLHEY
VDD