Protein Info for PFLU_RS26740 in Pseudomonas fluorescens SBW25

Annotation: sigma-54-dependent Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 635 PF00158: Sigma54_activat" amino acids 332 to 494 (163 residues), 214.4 bits, see alignment E=2.2e-67 PF14532: Sigma54_activ_2" amino acids 346 to 499 (154 residues), 64.8 bits, see alignment E=2.6e-21 PF07728: AAA_5" amino acids 351 to 471 (121 residues), 22.3 bits, see alignment E=2.8e-08 PF02954: HTH_8" amino acids 587 to 626 (40 residues), 47 bits, see alignment 4.3e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU5440)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K2P2 at UniProt or InterPro

Protein Sequence (635 amino acids)

>PFLU_RS26740 sigma-54-dependent Fis family transcriptional regulator (Pseudomonas fluorescens SBW25)
MHNDHFSRHAQQVLTVAHGRDPSSDPSIARSWLRCLEDYHLDPAQTIAPTVLEHGRLLES
RERLQQVLHIAGSEMNSLHQQLSGAGHAVLLTDARGVILNCVTAPSERKIFERAGLWLGA
DWSEACEGTNGIGTCLVERQSLTIHRDEHFRGRHTGLTCSASPVFDPHGDLLAVLDVSSA
REAVSRQSQFHTMALVNLSAKMIESCYFLRHFEHHWLLRFHLQAESVGLFSEGLLAFDGN
GRICAVNQSALNLLGQLRGGLLGQPVEAFFECSLDQLLGRASANATASWPLRTRDGRPLF
AALRGQARSVPAPVARPAVVERPRLPGICLGDPALQRDFSKALRVFERDVPLLINGETGS
GKEAFAKAVHQASQRADKAFVALNCAAIPESLIESELFGYRGGSFTGARKEGMQGKLQQA
DGGTLFLDEIGDMPLALQTRLLRVLEDRLVVPLGGEPQAVNVRIISATHRNLLERVQDGS
FREDLYYRLNGLEVGLPALRERSDKSQLLDFLLAQEANGEAVALDPAARMALLAFAWPGN
VRQLRTVLRTLVALCDEGRVALEDLPAQIRQARPVAAAQARPAESPLEDAERLALLTALQ
QQRWHMTHTAEQLGVSRNTLYRKLRRHGIARHALS