Protein Info for PFLU_RS26705 in Pseudomonas fluorescens SBW25

Annotation: murein hydrolase transporter LrgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details PF03788: LrgA" amino acids 13 to 106 (94 residues), 67.5 bits, see alignment E=4.2e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU5433)

Predicted SEED Role

"Antiholin-like protein LrgA" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K2N5 at UniProt or InterPro

Protein Sequence (117 amino acids)

>PFLU_RS26705 murein hydrolase transporter LrgA (Pseudomonas fluorescens SBW25)
MLLRGLTWLVLFQLIGTAINHLLLPVLPGPIIGLLLMLGFLVWRGEVGEPLSLAASSLLR
YLPLLLVPPAVGVMVYAKDIAADFWAIVGALVLSLVIAMGFVGVLMQQMVKRKEKDQ