Protein Info for PFLU_RS24785 in Pseudomonas fluorescens SBW25

Annotation: outer membrane protein assembly factor BamB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR03300: outer membrane assembly lipoprotein YfgL" amino acids 8 to 380 (373 residues), 441.3 bits, see alignment E=1.2e-136 PF13360: PQQ_2" amino acids 79 to 309 (231 residues), 168 bits, see alignment E=4.3e-53 amino acids 292 to 381 (90 residues), 23.4 bits, see alignment E=6.3e-09 PF13570: PQQ_3" amino acids 89 to 128 (40 residues), 18.9 bits, see alignment 2.6e-07 amino acids 129 to 168 (40 residues), 32.3 bits, see alignment 1.5e-11 amino acids 237 to 263 (27 residues), 19.1 bits, see alignment (E = 2.2e-07) PF01011: PQQ" amino acids 112 to 146 (35 residues), 29.1 bits, see alignment 9.1e-11

Best Hits

Swiss-Prot: 71% identical to BAMB_PSEAE: Outer membrane protein assembly factor BamB (bamB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU5054)

Predicted SEED Role

"Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K1L1 at UniProt or InterPro

Protein Sequence (383 amino acids)

>PFLU_RS24785 outer membrane protein assembly factor BamB (Pseudomonas fluorescens SBW25)
MRDVIRWKHAALLALAVLAAGCSSNSKKELPPAELTSFKEEVILQKQWSRSIGDGQGDTY
NMLVPAIDGENIVAADVTGVVISMDRMNGDVKWKKDLELPVSGAVGVGYGMVMLGTLKGE
VVALDSSTGEEKWRARVTSEVLAPPATNGDIVVVQTQDDRVIGLDASTGEQRWLYDSTPA
VLTLRGTSGPIVTNNLAVAGLSTGKVVALDTQNGVPAWETRVAIPQGRSELDRVVDIDGG
LLLSGETLYVATYQGRVAALDLQSGRVNWQRDASSYAGVAQGFGSVYVSLASGTVESVDE
RSTTALWSNDALARRQLSAPEVFSSYVAVGDFEGYLHLLSQVDGRFVGRERIDSDGLRAR
PLVVGNMLYVFGNSGKLEALTIK