Protein Info for PFLU_RS24390 in Pseudomonas fluorescens SBW25

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 46 to 365 (320 residues), 218.7 bits, see alignment E=4.9e-69 PF13533: Biotin_lipoyl_2" amino acids 70 to 114 (45 residues), 31.1 bits, see alignment 2.4e-11 PF16576: HlyD_D23" amino acids 72 to 269 (198 residues), 97.1 bits, see alignment E=1.4e-31 PF13437: HlyD_3" amino acids 166 to 266 (101 residues), 61 bits, see alignment E=2.4e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU4976)

Predicted SEED Role

"Probable RND efflux membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K189 at UniProt or InterPro

Protein Sequence (385 amino acids)

>PFLU_RS24390 efflux RND transporter periplasmic adaptor subunit (Pseudomonas fluorescens SBW25)
MPGRRMLTMLSIVLLVVLMLASYKAFWVYQQLQILHAPKPPVSVAVSNAFEKRWQRQLPA
AGTFKALQGINLSIEVPGVVTQLHFESGQRVDAGQPLLQLEHQTEQAELDMARADQRLAR
QNFERGKELVTINAISRGEYDRLSAELTRHNALVAQRSEALKKKSIVAPFSGIIGIRQVD
LGDFLQSGTVIASLQDTSSLYVDFHVPEQAAQLITIGQSVQVEVSARPGVFSLASVSAIN
PIVDDSTRNVLVRATLADPPKNVLPGMFADLRIQLADPQLHTVVAESAITFSPYGQYVYV
VAPPDDTQEHGLQEDGTPVLIAERRLIQSSERRDGLVVVDKGLHKGEQVVTAGQNKLVHG
TPVHISIDRNQPDDLPQATYRENEE