Protein Info for PFLU_RS24030 in Pseudomonas fluorescens SBW25

Annotation: fatty acid transporter membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03349: Toluene_X" amino acids 15 to 428 (414 residues), 374.7 bits, see alignment E=4.7e-116 PF02530: Porin_2" amino acids 207 to 419 (213 residues), 24.9 bits, see alignment E=1.3e-09

Best Hits

KEGG orthology group: K06076, long-chain fatty acid transport protein (inferred from 100% identity to pfs:PFLU4903)

Predicted SEED Role

"Long-chain fatty acid transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JYR7 at UniProt or InterPro

Protein Sequence (428 amino acids)

>PFLU_RS24030 fatty acid transporter membrane protein (Pseudomonas fluorescens SBW25)
MNNKTLKGALALAVSLASTQLFAGGFALNEQSISSMGTGYAGRSSSAEDASTVFGNPAGM
SRLKKNEVSLGATYLDAKTDIKDASSSQFGANNPGTNKGDMVPGIAVPMGYLVTPIDEHW
AFGLGIYAPFGLVTDYEHSFQGNAFGSKSKVSVITVQPTVSYAFNDKVSVGFGPTFNRID
GELDSNVPLGGGAGESVKVKGNDNAAGFNAGILVQPLDSTRIGVTYHSQVVYHLSGKTHA
SGLISDTFDGGPQKYDASLDLTTPSSVDFSVTQQLNDDWTLYLGSTYTRWSQLKKITINN
DGVSDLTAQFGGLGSITEQQHWHDTWSHAIGAAYRVNKALVLRTGFSVDQTPTNNTDRSV
RIPTGDRTVFSLGAGWTPVDNLTFDVAYSYLKEEPIKVRQNLSQVGLTYDAKYENSANGF
GGSVTYRF