Protein Info for PFLU_RS23615 in Pseudomonas fluorescens SBW25

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF01370: Epimerase" amino acids 6 to 183 (178 residues), 77.1 bits, see alignment E=5e-25 PF13460: NAD_binding_10" amino acids 10 to 114 (105 residues), 30.6 bits, see alignment E=1.1e-10 PF01073: 3Beta_HSD" amino acids 41 to 119 (79 residues), 37.7 bits, see alignment E=4.5e-13 PF16363: GDP_Man_Dehyd" amino acids 42 to 163 (122 residues), 46.5 bits, see alignment E=1.3e-15 PF05368: NmrA" amino acids 44 to 113 (70 residues), 23.7 bits, see alignment E=1.1e-08 PF02719: Polysacc_synt_2" amino acids 47 to 153 (107 residues), 23.3 bits, see alignment E=1.2e-08 PF07993: NAD_binding_4" amino acids 56 to 165 (110 residues), 21.5 bits, see alignment E=4.2e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU4816)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JZ50 at UniProt or InterPro

Protein Sequence (245 amino acids)

>PFLU_RS23615 NAD(P)-dependent oxidoreductase (Pseudomonas fluorescens SBW25)
MKGLNVLLTGACGRIGKTFFEGSKDRYRFTLTDRIAPDFDVGQHRFVHADLSDQSSLVAL
LDGIDVIVHLSGIPHASASFDELLPNNILATTYLFDAAVNAGVKRLVFASSAQTIEGYPV
DRQITPGMPVLPANLYGVSKCYGEALCGYYAAKTPLSTIALRIGAFEFPETHDLNNARDL
SAWLSPRDAVQLLQRSVEAEGVKHLIAHGISNNRFKRLDLSETTRMLGYHPQDDAFQTFE
IPITY