Protein Info for PFLU_RS22300 in Pseudomonas fluorescens SBW25

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 33 to 54 (22 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details amino acids 272 to 289 (18 residues), see Phobius details PF00892: EamA" amino acids 7 to 136 (130 residues), 67.2 bits, see alignment E=9.4e-23 amino acids 149 to 289 (141 residues), 56.7 bits, see alignment E=1.7e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU4549)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K140 at UniProt or InterPro

Protein Sequence (299 amino acids)

>PFLU_RS22300 EamA family transporter (Pseudomonas fluorescens SBW25)
MRPVDTLYLLGLAAIWGASFLFMRIIAPEIGTLPTAFFRVSIAAAGLLVILAAMRVKWDF
QGKFKTVLLLGVINSGIPATMYSVAAQVLPAGYSAIFNATTPLMGVLIGGLFFSERLTPS
KVAGVCLGLLGVGVLTRAGPVAFDLELLMGALACLLATTCYGFAGFLARRWLDQRGGLDS
RLSALGSMLGATLFLLPFFAYSAVSQPPASWGGWQVWLSLLGLGLVCTAFAYILYFRLLT
AIGPVKSMTVTFMIPPFGVLWGALLLDEPLSMAHLYGGVLIAGALWLVLRPKKLSARLG