Protein Info for PFLU_RS15965 in Pseudomonas fluorescens SBW25

Annotation: FAD-binding oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01946: Thi4
  • amino acids 20 to 76 (57 residues), 28.7 bits, 1.2e-10
• PF01266: DAO
  • amino acids 30 to 384 (355 residues), 179 bits, E=3e-56

Best Hits

KEGG orthology group: K09471, gamma-glutamylputrescine oxidase [EC: 1.4.3.-] (inferred from 100% identity to pfs:PFLU3278)

Predicted SEED Role

"FIG00553873: hypothetical protein"

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.-

Use Curated BLAST to search for 1.4.3.-

Sequence Analysis Tools

See C3KC78 at UniProt or InterPro

Protein Sequence (432 amino acids)

>PFLU_RS15965 FAD-binding oxidoreductase (Pseudomonas fluorescens SBW25)
MINIETPTYYSATKKYNLSFPTLEQDVEADVVVIGGGFSGINTALELAEKGITNIVVLEA
RYLGFGGTGRNGGQIMAGIGHDLEKIKNQVGDEGLRQIFEISELGAGIIKDRIAKYAIDA
DFCHGYGYMGFNARQEKTLRAWEKDFQSINTKDEIRFMAGSEVKQIIGSDAYTSALLHMG
GGHVHSLNLLLGEAKALAGHGVRIFEHSPALEVSYGERITVRTGRGSVKAAKLLWACDSF
LNKLEPELHKTTVNTYAFQLMTEPLSDEMIHRISPIRGAYSDIRPVIDYYRVTNENRLLF
GAATPFVEHIPLDLKAWNRNLMLKIFPYLKDVKIDLAWGGPMATGANLFPQIGTLSGRPN
AFYVQGYAGFGVTPSHIICKVLAEGMSEGSSRYDLISSVKHAQILGKDHIRPLLLTAGKS
LHQLSGYFNGRR