Protein Info for PFLU_RS13660 in Pseudomonas fluorescens SBW25

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

Swiss-Prot: 87% identical to NICX_PSEPK: 2,5-dihydroxypyridine 5,6-dioxygenase (nicX) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2800)

MetaCyc: 87% identical to 2,5-dihydroxypyridine dioxygenase (Pseudomonas putida KT2440)
2,5-dihydroxypyridine 5,6-dioxygenase. [EC: 1.13.11.9]

Predicted SEED Role

"Leucyl aminopeptidase (aminopeptidase T)"

MetaCyc Pathways

nicotinate degradation I (6/6 steps found)
picolinate degradation (4/7 steps found)
nicotine degradation II (pyrrolidine pathway) (6/11 steps found)
nicotine degradation III (VPP pathway) (5/10 steps found)
superpathway of nicotinate degradation (6/18 steps found)

KEGG Metabolic Maps

Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K9X8 at UniProt or InterPro

Protein Sequence (350 amino acids)

>PFLU_RS13660 hypothetical protein (Pseudomonas fluorescens SBW25)
MPVSDCELTQMFEHVLTLSKVDPTQSVAVLKSHYSDPRTVRAAMDAAQRLGAKVYAVELP
SFNHPKAMGNDMTAYCGDTALTGNIAAQRALEAADLIVDTMMLLHSPEQEQILKTGTRIL
LAVEPPEVLARMLPTEEDKVRVLAAEQWLKKARSIQVTSRAGSDFRAALGQYPSVTEYGF
ADEPGRWDHWPSGFLFSWPNEETAEGVLVLDIGDILLPFKTYTREKITLEIEKGFITNIH
GGFEAEYLRDYMKYFNDPEVYGISHIGWGLQPRAQWTAMGLHDKNDGMCMDARAFYGNFL
FSTGPNTEVGGTRKTPCHMDIPLRNCDVYLDNEAVVIAGDVVAPRASLAR