Protein Info for PFLU_RS11175 in Pseudomonas fluorescens SBW25

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 9 to 158 (150 residues), 43.2 bits, E=1.1e-14
• PF05368: NmrA
  • amino acids 10 to 117 (108 residues), 22.8 bits, E=2.2e-08
• PF01370: Epimerase
  • amino acids 10 to 183 (174 residues), 92.4 bits, E=1.2e-29
• PF16363: GDP_Man_Dehyd
  • amino acids 11 to 169 (159 residues), 60.8 bits, E=6.6e-20
• PF01073: 3Beta_HSD
  • amino acids 12 to 151 (140 residues), 56.1 bits, E=1.2e-18
• PF13460: NAD_binding_10
  • amino acids 14 to 141 (128 residues), 43.1 bits, E=1.8e-14
• PF07993: NAD_binding_4
  • amino acids 60 to 175 (116 residues), 31 bits, E=6.1e-11

Best Hits

Swiss-Prot: 67% identical to URODH_PSEPK: Uronate dehydrogenase (udh) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2274)

MetaCyc: 67% identical to uronic acid dehydrogenase subunit (Pseudomonas syringae)
Uronate dehydrogenase. [EC: 1.1.1.203]; 1.1.1.203 [EC: 1.1.1.203]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• D-galacturonate degradation III (2/2 steps found)
• D-glucuronate degradation III (2/2 steps found)
• D-glucuronate degradation II (4/5 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• D-galacturonate degradation II (3/5 steps found)
• D-galactose detoxification (1/3 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (13/31 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 1.1.1.203 or 5.1.3.2

Sequence Analysis Tools

See C3KAR3 at UniProt or InterPro

Protein Sequence (271 amino acids)

>PFLU_RS11175 NAD(P)-dependent oxidoreductase (Pseudomonas fluorescens SBW25)
MTTTKPFNRILLTGAAGGLGQILRETLQAHAHIVRASDISLLTPSAGAHDEVVQCDLADK
KAVHALLKDVDAIVHMGGISVERAFEAILDANIRGTFHLYEAARKHGIKRVVFASSNHVT
GFHTQDQPLDAHSERRPDGYYALSKAYGEDLASFYFQRYGIETVSLRIGSSFAQPRNRRM
LSTWLSYRDLDHLIERALLARDVGHTVVYGVSANRTTWWDNRHAAHLGFNPQDSSEAFRD
TVERQPEPGENDPDRLFQGGAFTAAGPFDTD