Protein Info for PFLU_RS05280 in Pseudomonas fluorescens SBW25

Annotation: multicopper oxidase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF07732: Cu-oxidase_3" amino acids 56 to 163 (108 residues), 106 bits, see alignment E=2e-34 PF00394: Cu-oxidase" amino acids 347 to 455 (109 residues), 26.4 bits, see alignment E=1e-09 PF07731: Cu-oxidase_2" amino acids 351 to 457 (107 residues), 98.4 bits, see alignment E=4.8e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU1064)

MetaCyc: 82% identical to CumA multicopper oxidase (Pseudomonas putida GB-1)

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K6Z1 at UniProt or InterPro

Protein Sequence (458 amino acids)

>PFLU_RS05280 multicopper oxidase family protein (Pseudomonas fluorescens SBW25)
MSRSFSRRQILGGLAGLAVVGVGAGGAYRYWLGKVAEAEAGHDYELIAAPLNVELVPGHK
TEAWAFGPSAPGTELRVRQGEWLRVRFINHLPVATTIHWHGIRLPLEMDGVPYVSQLPVL
PGEYFDYKFRVPDAGSYWYHPHVNSSEELGRGLVGPLIIEEREPTGFKHERTLSLKSWHV
DEEGAFVAFSVPREAARGGTAGRLSTINGVSQAVIDLPAGQITRVRLLNLDNTLTYRLNI
PDVEAQIYALDGNPIEPRPLGKEYWLGPGMRICLAIKAPPAGEELSIRNGPVRLGTFRSV
VNTDAPTDWPPALPANPISEPDLANAEKLNFHFEWVGSVSVDDGKPPSLWQINGKAWDIT
DKTCADRPIARLEKGKSYIFELKNMTQYQHPIHLHGMSFKVIASNRHKVIPYFTDTYLLG
KNERARVALVADNPGVWMFHCHVIDHMETGLMAAIEVA