Protein Info for PFLU_RS04385 in Pseudomonas fluorescens SBW25
Annotation: RNase adapter RapZ
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to Y879_PSEFS: Nucleotide-binding protein PFLU_0879 (PFLU_0879) from Pseudomonas fluorescens (strain SBW25)
KEGG orthology group: K06958, UPF0042 nucleotide-binding protein (inferred from 100% identity to pfs:PFLU0879)Predicted SEED Role
"Hypothetical ATP-binding protein UPF0042, contains P-loop"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See C3K839 at UniProt or InterPro
Protein Sequence (285 amino acids)
>PFLU_RS04385 RNase adapter RapZ (Pseudomonas fluorescens SBW25) MRLIIVSGRSGSGKSTALNVLEDNGFYCIDNLPAGLLPELAERALIHTELAQPLVAVSID ARNLPSHLERFPQLLEEVRAKHIHCDVLYLDADEETLLKRFSETRRRHPLSSPHRSLAEA IEDETKLLGPIIDLADLKINTTSLNLYQLRDAIKLRLLNQPEPGTAFLVESFGFKRGMPV DADLVFDVRCLPNPYWKPELRDQSGLDQPVADYLAAQPDVEEMFQDISSYLLKWLPRFAA SNRAYVTIAIGCTGGHHRSVYLTERLGQVLQKTLKNVQVRHRDLS