Protein Info for PFLU_RS03780 in Pseudomonas fluorescens SBW25

Annotation: phosphate acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 699 transmembrane" amino acids 270 to 288 (19 residues), see Phobius details PF13500: AAA_26" amino acids 2 to 213 (212 residues), 112.4 bits, see alignment E=3.8e-36 PF07085: DRTGG" amino acids 217 to 328 (112 residues), 90 bits, see alignment E=1.2e-29 PF01515: PTA_PTB" amino acids 374 to 689 (316 residues), 376.5 bits, see alignment E=1.9e-116 TIGR00651: phosphate acetyltransferase" amino acids 389 to 689 (301 residues), 379 bits, see alignment E=9.8e-118

Best Hits

Swiss-Prot: 87% identical to PTA_PSEPK: Phosphate acetyltransferase (pta) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K13788, phosphate acetyltransferase [EC: 2.3.1.8] (inferred from 100% identity to pfs:PFLU0763)

Predicted SEED Role

"Phosphate acetyltransferase (EC 2.3.1.8)" in subsystem Ethanolamine utilization or Fermentations: Lactate or Fermentations: Mixed acid or MLST or Propanediol utilization or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Threonine anaerobic catabolism gene cluster (EC 2.3.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KDP4 at UniProt or InterPro

Protein Sequence (699 amino acids)

>PFLU_RS03780 phosphate acetyltransferase (Pseudomonas fluorescens SBW25)
MQTFFIAPTDFGVGLTSISLGLVRTLERAGLKVGFFKPIAQPHPGDTGPERSTELVARTH
GLKPPQPLGLAHVERMLGDGQLDELLEEIITLYQQAAVGKDVLIVEGMVPTRNASYAARV
NLHLAKSLDAEVILVSAPENEVLTELSGRVELQAQLFGGPKDPKVLGVILNKVRTEESME
AFSARLKEHSPLLRSGDFRLLGCIPYQPELNAPRTRDVADLMGAQILNAGDYETRRMTKI
IICARTMRNTVELLKPGVLVVTPGDRDDIILAVSLAAINGVPLAGLLLTSDTLPDPRIMD
LCRGAFQAGLPVLSVSTGSYDTANQLNSLNKEIPIDDRERAEIITDFVASHLDARWLHQR
CGTPREMRLSPAVFRYQLIQRAQAANKRIVLPEGSEPLTVQAAAICQARGIARCVLLAKP
ADVEAVARAQGIELPEGLEILDPDLIRQRYVEPMVALRKSKSLNAPMAEQQLEDTVVIAT
MMLALDEVDGLVSGVIHSTANTIRPALQLIKTAPGCTLVSSVFFMLFPEQVLVYGDCVMN
PHPSAAELAEIALQSADSAAAFGITPRVAMISYSSGDSASGEEVEKVREATLLAHEQQSS
LLIDGPLQYDAAANETVARQLAPNSLVAGKATVFVFPDLNTGNTTHKAVQRSADCVSLGP
MLQGLRKPVNDLPRGAQVDDIVYTIALTAIQAANRPMDI