Protein Info for PFLU_RS03505 in Pseudomonas fluorescens SBW25

Annotation: D-alanine--D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF01820: Dala_Dala_lig_N" amino acids 5 to 130 (126 residues), 120.6 bits, see alignment E=1.2e-38 TIGR01205: D-alanine--D-alanine ligase" amino acids 5 to 350 (346 residues), 366.6 bits, see alignment E=4.6e-114 PF02786: CPSase_L_D2" amino acids 140 to 318 (179 residues), 20.9 bits, see alignment E=4.4e-08 PF07478: Dala_Dala_lig_C" amino acids 147 to 348 (202 residues), 255.3 bits, see alignment E=7.5e-80 PF02222: ATP-grasp" amino acids 149 to 317 (169 residues), 49.5 bits, see alignment E=7.8e-17

Best Hits

Swiss-Prot: 67% identical to DDLA_SALTY: D-alanine--D-alanine ligase A (ddlA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 100% identity to pfs:PFLU0706)

MetaCyc: 65% identical to D-alanine--D-alanine ligase A (Escherichia coli K-12 substr. MG1655)
D-alanine--D-alanine ligase. [EC: 6.3.2.4]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.4

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KBW8 at UniProt or InterPro

Protein Sequence (364 amino acids)

>PFLU_RS03505 D-alanine--D-alanine ligase (Pseudomonas fluorescens SBW25)
MSKVRVGIIFGGRSAEHEVSLQSARNIVDALDRTRFEPVLIGIDKAGHWHLNDTSNFLLN
QENPALIALNQSNRELAVVPGKASQQLVETSGTGLLEHVDVIFPIVHGTLGEDGCLQGLL
RMADLPFVGSDVLGSAVCMDKDISKRLLRDAGIAVTPFITLTRSNATRTSFDTAVNTLGL
PMFVKPANQGSSVGVSKVGTEAEYHAAVELALGFDEKVLVESAVKGREIECAVLGNEHPI
ASGCGEIVVSSGFYSYDSKYIDDQAAQVVVPAAISHDASERIRGLAIEAFEVLGCSGLAR
VDVFLTDDGNVLINEINSLPGFTRISMYPKLWQAAGMSYSELVSRLIELALERHAGRKGL
KISR