Protein Info for PFLU_RS02390 in Pseudomonas fluorescens SBW25

Annotation: NAD-dependent epimerase/dehydratase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 4 to 233 (230 residues), 51.6 bits, E=3.1e-17
• PF01370: Epimerase
  • amino acids 5 to 242 (238 residues), 230 bits, E=1.1e-71
• PF02719: Polysacc_synt_2
  • amino acids 5 to 231 (227 residues), 54.4 bits, E=4.6e-18
• PF05368: NmrA
  • amino acids 5 to 120 (116 residues), 32.1 bits, E=3.2e-11
• PF16363: GDP_Man_Dehyd
  • amino acids 6 to 254 (249 residues), 178.1 bits, E=1.3e-55
• PF01073: 3Beta_HSD
  • amino acids 6 to 230 (225 residues), 93.8 bits, E=3.9e-30
• PF07993: NAD_binding_4
  • amino acids 7 to 192 (186 residues), 39.5 bits, E=1.5e-13
• PF13460: NAD_binding_10
  • amino acids 9 to 156 (148 residues), 62.6 bits, E=1.9e-20

Best Hits

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 100% identity to pfs:PFLU0483)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• D-galactose detoxification (1/3 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

See C3KDB9 at UniProt or InterPro

Protein Sequence (308 amino acids)

>PFLU_RS02390 NAD-dependent epimerase/dehydratase family protein (Pseudomonas fluorescens SBW25)
MSKQVLITGGAGFIGSHLVDALLAKGYGVRVLDNLSTGKRSNLPLHDPRVELLEGDVADA
DLVARAAVGATAVVHLAAVASVQASVDDPVSTHQSNFVGTLNVCEAMRKAGVKRVVYASS
AAVYGNNGEGASIDEETTKAPLTPYASDKLASEHYFDFYRRQHGLEPVIFRFFNIFGPRQ
DPSSPYSGVISIFSERVQQGVPIAVFGDGEQTRDFMYVEDLVDVLVQAIEAPAAPLGAIN
VGWNRTTTLKQVLQALEEVVGTLPTITYGPARSGDIRHSRANNQRLLASFTLPEPTPLKV
GLERLLNG