Protein Info for PFLU_RS00325 in Pseudomonas fluorescens SBW25

Annotation: heme A synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 79 to 96 (18 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details PF02628: COX15-CtaA" amino acids 7 to 316 (310 residues), 269.7 bits, see alignment E=1.6e-84

Best Hits

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 100% identity to pfs:PFLU0065)

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K699 at UniProt or InterPro

Protein Sequence (359 amino acids)

>PFLU_RS00325 heme A synthase (Pseudomonas fluorescens SBW25)
MAKPGFRLALFATLLALIVVLLGAYTRLTHAGLGCPDWPGCYGFISVPKTEAQLAHAELH
FPDTPVEADKGWAEMTHRYFAGTLGLLIVLLAARSWGHRRDPGQPVKLPLFVLAVVFAQA
AFGMWTVTLKLWPQVVTGHLLGGFATLSLLFLLTLRLSGVLPALIVPKRLQYWATAGLVL
VIGQIALGGWVSSNYAAVACIDLPTCHGEWWPAADFANGFHLTQHIGPNYLGGQLDSEAR
TAIHLTHRMGAVIVSLVLFGLAWQLRAVGMTRLAGLLLIALAAQICLGLSNVYFHLPLPV
AVGHNAGGAALLLTLVLVNYHARTSLVRVRNQLPFGWRFIPRKHVSGLITLKGEMPWRP