Protein Info for OLJFJH_03210 in Erwinia amylovora T8

Annotation: sugar dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF00106: adh_short" amino acids 8 to 201 (194 residues), 209.4 bits, see alignment E=9.2e-66 PF23441: SDR" amino acids 11 to 253 (243 residues), 35.6 bits, see alignment E=1.7e-12 PF08659: KR" amino acids 12 to 163 (152 residues), 36.5 bits, see alignment E=1.2e-12 PF13561: adh_short_C2" amino acids 16 to 252 (237 residues), 219.8 bits, see alignment E=9.9e-69

Best Hits

Swiss-Prot: 56% identical to DHG_BACSU: Glucose 1-dehydrogenase (gdh) from Bacillus subtilis (strain 168)

KEGG orthology group: K00034, glucose 1-dehydrogenase [EC: 1.1.1.47] (inferred from 100% identity to eay:EAM_0356)

MetaCyc: 56% identical to glcDH (Bacillus subtilis)
Glucose 1-dehydrogenase. [EC: 1.1.1.47]

Predicted SEED Role

"Glucose 1-dehydrogenase (EC 1.1.1.47)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 1.1.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>OLJFJH_03210 sugar dehydrogenase (Erwinia amylovora T8)
MYTDLQGKVAAVTGSSRGIGAALVTRLVEEGMNVVINYHSNKEEAQELADKLNARRSGKA
IVFGGDISDENVAHHFVHSAIENFGQLDLLINNAGIEIQSPAHKITLEDWRKVIDVNLTS
YFLTARSALNYFTEKNIKGNIINISSVHEIIPWPTFVSYAASKGGIRMLTQSLALEYAEK
GIRVNAIGPGAINTPMNQEKMGDEALRLELEELIPMKFVAEPEVVANVAAWLASEQSAYV
TGQTLFVDGGMTLYPSFQGGKG