Protein Info for OKGIIK_16300 in Rhodanobacter sp. FW510-T8

Annotation: Cytochrome C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR03508: decaheme c-type cytochrome, DmsE family" amino acids 106 to 373 (268 residues), 260.9 bits, see alignment E=1.2e-81 PF14537: Cytochrom_c3_2" amino acids 197 to 284 (88 residues), 30.4 bits, see alignment E=1.1e-10 PF09699: Paired_CXXCH_1" amino acids 204 to 238 (35 residues), 27.8 bits, see alignment 4e-10 amino acids 246 to 288 (43 residues), 47.7 bits, see alignment 2.4e-16 amino acids 295 to 332 (38 residues), 43.5 bits, see alignment 5.1e-15 TIGR01905: doubled CXXCH domain" amino acids 246 to 287 (42 residues), 34.1 bits, see alignment 1.9e-12 amino acids 295 to 332 (38 residues), 38.9 bits, see alignment 6.3e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>OKGIIK_16300 Cytochrome C (Rhodanobacter sp. FW510-T8)
MRVISLFLAALLCVMLGAATMLLGSRDLQAQQAATSDPAATGNGHAPASGLSQSDIARML
PATDMGANAARQNNPHLASMGDSPATPFDGAPIPANPLAPNADAVGAKTCVACHAQENVQ
ASHSLHVASFRAGAANTGPQAACESCHGPGSEHAKDPTAPGKIIAFTHDAKTSPQTQAGV
CLSCHAGGARQHWIGSIHQNRGLSCTDCHNPMARLSPEGVLAKSSINEVCATCHQDIRAK
FNRRSHMPLPEGQMACTDCHNPHGSITKPLLKTDTVNETCYTCHAEKRGPFLFEHAPVRQ
NCLNCHDVHGSNQQTLLVAPIPMLCQQCHTMTRHPNDLQGAAGLGTGPHPDERLMGRGCL
SCHANIHGSNNPSGPKFHK