Protein Info for OKGIIK_15640 in Rhodanobacter sp. FW510-T8

Annotation: NADP-dependent 3-hydroxy acid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 4 to 188 (185 residues), 167.7 bits, E=3.4e-53
• PF08659: KR
  • amino acids 6 to 166 (161 residues), 42.7 bits, E=9.2e-15
• PF13561: adh_short_C2
  • amino acids 10 to 220 (211 residues), 115 bits, E=6.2e-37

Best Hits

Swiss-Prot: 62% identical to SDH_RHIRD: Serine 3-dehydrogenase (sdh) from Rhizobium radiobacter

KEGG orthology group: None (inferred from 72% identity to xoo:XOO0491)

MetaCyc: 54% identical to sulfoacetaldehyde reductase monomer (Chromohalobacter salexigens DSM 3043)
RXN-12148 [EC: 1.1.1.313]

Predicted SEED Role

"Oxidoreductase"

MetaCyc Pathways

• sulfoacetaldehyde degradation III (1/1 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.313

Protein Sequence (251 amino acids)

>OKGIIK_15640 NADP-dependent 3-hydroxy acid dehydrogenase (Rhodanobacter sp. FW510-T8)
MTTKTAWITGATSGFGAATVERFVAGGWRVIASGRRMERLQQLVARHGAERVHPMAFDVR
DETAMRAAHAGLPSAFAGIDLLVNNAGLALGTAPAQQADLVQWKQMIDTNVTALVTLTHL
LLPQLIARRGAIVNISSISGSYAYRGGNVYGGTKAFVTQFSQNLRVDLHGSGVRVSSIEP
GMAETEFTLVRTGGDQAASDQLYAGVHPITAGDIADTIWWIANLPPHLDVTRLEIMPTSQ
SAAGLQVARDG