Protein Info for OKGIIK_15640 in Rhodanobacter sp. FW510-T8

Annotation: NADP-dependent 3-hydroxy acid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF00106: adh_short" amino acids 4 to 188 (185 residues), 167.7 bits, see alignment E=3.4e-53 PF08659: KR" amino acids 6 to 166 (161 residues), 42.7 bits, see alignment E=9.2e-15 PF13561: adh_short_C2" amino acids 10 to 220 (211 residues), 115 bits, see alignment E=6.2e-37

Best Hits

Swiss-Prot: 62% identical to SDH_RHIRD: Serine 3-dehydrogenase (sdh) from Rhizobium radiobacter

KEGG orthology group: None (inferred from 72% identity to xoo:XOO0491)

MetaCyc: 54% identical to sulfoacetaldehyde reductase monomer (Chromohalobacter salexigens DSM 3043)
RXN-12148 [EC: 1.1.1.313]

Predicted SEED Role

"Oxidoreductase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.313

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>OKGIIK_15640 NADP-dependent 3-hydroxy acid dehydrogenase (Rhodanobacter sp. FW510-T8)
MTTKTAWITGATSGFGAATVERFVAGGWRVIASGRRMERLQQLVARHGAERVHPMAFDVR
DETAMRAAHAGLPSAFAGIDLLVNNAGLALGTAPAQQADLVQWKQMIDTNVTALVTLTHL
LLPQLIARRGAIVNISSISGSYAYRGGNVYGGTKAFVTQFSQNLRVDLHGSGVRVSSIEP
GMAETEFTLVRTGGDQAASDQLYAGVHPITAGDIADTIWWIANLPPHLDVTRLEIMPTSQ
SAAGLQVARDG