Protein Info for OKGIIK_12715 in Rhodanobacter sp. FW510-T8

Name: rsgA
Annotation: ribosome small subunit-dependent GTPase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 TIGR00157: ribosome small subunit-dependent GTPase A" amino acids 67 to 315 (249 residues), 142.1 bits, see alignment E=1.1e-45 PF03193: RsgA_GTPase" amino acids 85 to 260 (176 residues), 161.1 bits, see alignment E=3.8e-51 PF00005: ABC_tran" amino acids 188 to 225 (38 residues), 27.2 bits, see alignment 8.3e-10 PF01926: MMR_HSR1" amino acids 196 to 257 (62 residues), 26.6 bits, see alignment E=8.5e-10

Best Hits

KEGG orthology group: K06949, ribosome biogenesis GTPase [EC: 3.6.1.-] (inferred from 48% identity to sus:Acid_3280)

Predicted SEED Role

"Probable GTPase related to EngC" in subsystem Universal GTPases

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>OKGIIK_12715 ribosome small subunit-dependent GTPase A (Rhodanobacter sp. FW510-T8)
MSDAETIERLRRIGWRGEALPAGGLRLARVVAQHRAGYELHDGANLFGAQPDGRFLKRGL
DPAERPVVGDFVEVAAGTPPHIVSVLPRRTVLSRAAAGERYERQLIATNIDYVLVLTGLD
GDFNPARIERYLSLTEDSGAQPVVLLSKLDVREDAAAQVAALRARLPAGTPIHALNGKDP
ASVASLAAYLQPGDSAVLVGSSGAGKSTLTNTLLGTARMATAAVRSHDSRGRHTTTHRAL
LQLPSGGCLIDTPGMRELKLTGEENLDLFADIGLLAEQCRFADCGHGSEPGCAVQAALDN
GELTAARWRNYLKLHDEREEQAATLEARLRRQRGGRPIERPHGHRGRHERE