Protein Info for OKGIIK_11420 in Rhodanobacter sp. FW510-T8

Name: ribB
Annotation: bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR00506: 3,4-dihydroxy-2-butanone-4-phosphate synthase" amino acids 3 to 199 (197 residues), 235.4 bits, see alignment E=2.2e-74 PF00926: DHBP_synthase" amino acids 8 to 198 (191 residues), 281.3 bits, see alignment E=3.2e-88 PF00925: GTP_cyclohydro2" amino acids 208 to 363 (156 residues), 132.5 bits, see alignment E=1.2e-42

Best Hits

KEGG orthology group: K14652, 3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC: 3.5.4.25 4.1.99.12] (inferred from 65% identity to xcv:XCV0801)

Predicted SEED Role

"3,4-dihydroxy-2-butanone 4-phosphate synthase / GTP cyclohydrolase II (EC 3.5.4.25)" in subsystem Riboflavin, FMN and FAD metabolism or Molybdenum cofactor biosynthesis (EC 3.5.4.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.25 or 4.1.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>OKGIIK_11420 bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II (Rhodanobacter sp. FW510-T8)
MAFNTIPEILEDIRAGRMVVILDDEDRENEGDLIMAAQMVRPEDVNFMVREARGLLCLTL
TEQRTRQLGLRPMVSDNTSAYHTNFTVSIEAAEGVTTGISAHDRARTIQVAVKSDAKPQD
LSQPGHIFPLTAQPGGVLTRAGHTEAGCDLAALAGLEPSAVLIEILHEDGSMARRPELEI
FAQKHGLKIGTIAELIRYRLETEKTVQRVHEEDVDTEFGPFRLVAYRDAIRHGLHYALVR
GRVNDGAPVLTRVHVRNTLSDVLHLKRDDLGLTVTAALRRIADEDRGVLLVLSGEDTPEA
LLARLNRQPGKQAPEEAQQQEWRQLGLGAQILADLGVHRLRVLGTPRKMVGLGGFGLEVV
EYV