Protein Info for OKGIIK_09950 in Rhodanobacter sp. FW510-T8

Name: sufS,csdA
Annotation: cysteine desulfurase CsdA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 63% identical to CSD_XYLFA: Probable cysteine desulfurase (csd) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K11717, cysteine desulfurase / selenocysteine lyase [EC: 2.8.1.7 4.4.1.16] (inferred from 67% identity to xca:xccb100_1392)

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7), SufS subfamily" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

superpathway of thiamine diphosphate biosynthesis II (10/11 steps found)
superpathway of L-alanine biosynthesis (4/4 steps found)
thiazole component of thiamine diphosphate biosynthesis II (6/7 steps found)
superpathway of thiamine diphosphate biosynthesis I (8/10 steps found)
L-alanine biosynthesis III (1/1 steps found)
L-cysteine degradation IV (1/1 steps found)
thiazole component of thiamine diphosphate biosynthesis I (4/6 steps found)
cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
tRNA-uridine 2-thiolation (mammalian mitochondria) (1/4 steps found)
tRNA-uridine 2-thiolation (yeast mitochondria) (1/4 steps found)
molybdopterin biosynthesis (2/6 steps found)
tRNA-uridine 2-thiolation (thermophilic bacteria) (1/5 steps found)
tRNA-uridine 2-thiolation (cytoplasmic) (1/8 steps found)
tRNA-uridine 2-thiolation and selenation (bacteria) (3/11 steps found)
[2Fe-2S] iron-sulfur cluster biosynthesis (2/10 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7 or 4.4.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>OKGIIK_09950 cysteine desulfurase CsdA (Rhodanobacter sp. FW510-T8)
MTASQASTPTVFDVRRIRADFPLLARSVHGKPLVYLDNANTSQKPESVIAAVDNHYREHN
ANVARAVHQLGEEATAAYEGARDKLARFINAPSRNEVILTTGTTQSINLVAYSYALPQLK
PGDSILTTVMEHHANIVPWQLVAARSGATVKAAPIDERGELIVEKYLEMLTPEVKLACVT
HVSNVLGTVNPVREIARECRKRGIALLVDGSQAAPHRPVDVQVLGCDFYAVTGHKMLGPT
GTGVLWAKREHLEAMPPFFGGGEMIREVRFSGTTFAAPPHKFEAGTPNIAGFVGLSAAVD
YYESVGFEAIHAWEQQLLHYATERLHGIPGLRIIGEAAQKEPVISFLLEGAQATDLATLL
DLQGVAVRSGHHCAHPLMQFYGVPATLRVSLAFYNTREEIDAFIVALLKVRKLLL