Protein Info for OKGIIK_09515 in Rhodanobacter sp. FW510-T8

Name: gph
Annotation: phosphoglycolate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF00702: Hydrolase" amino acids 10 to 184 (175 residues), 97.1 bits, see alignment E=3.6e-31 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 11 to 219 (209 residues), 189 bits, see alignment E=1.7e-59 PF13419: HAD_2" amino acids 11 to 190 (180 residues), 116.5 bits, see alignment E=3.1e-37 PF12710: HAD" amino acids 11 to 179 (169 residues), 42.8 bits, see alignment E=1.6e-14 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 78 to 184 (107 residues), 37.1 bits, see alignment E=8.3e-13 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 78 to 190 (113 residues), 37.4 bits, see alignment E=5.7e-13 PF13242: Hydrolase_like" amino acids 146 to 210 (65 residues), 36.5 bits, see alignment E=7.5e-13

Best Hits

Swiss-Prot: 46% identical to MUPP_PSEAE: N-acetylmuramic acid 6-phosphate phosphatase (mupP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 53% identity to cti:RALTA_A0767)

MetaCyc: 44% identical to N-acetyl-beta-muramate 6-phosphate phosphatase (Pseudomonas putida KT2440)
RXN-18659 [EC: 3.1.3.105]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.105 or 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>OKGIIK_09515 phosphoglycolate phosphatase (Rhodanobacter sp. FW510-T8)
MKPLPENLQGVLFDLDGTLLDSAPDLYAALRVQCAEEGVPPPPYAPVREVVSRGARAVLR
CAFAARGEPALEALMPRYLQLYQDVMAQQTRAFDGIDELLARIEAHGLRWGIVTNKAAFL
TDELVRRIGWAGRAKAVISGDTLPVKKPDPAPVLLACEHADVAPARCVFVGDDRRDVQAG
AAAGLYTVAVGWGYLDGGDPRRWGADAVLDHPAELADLLKLQPVPA