Protein Info for OKGIIK_09140 in Rhodanobacter sp. FW510-T8

Annotation: EamA-like transporter family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 235 to 252 (18 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details PF00892: EamA" amino acids 3 to 136 (134 residues), 47.7 bits, see alignment E=9.3e-17 amino acids 145 to 274 (130 residues), 33.7 bits, see alignment E=1.9e-12

Best Hits

KEGG orthology group: None (inferred from 69% identity to xal:XALc_2976)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>OKGIIK_09140 EamA-like transporter family (Rhodanobacter sp. FW510-T8)
MFKGVLLGFTAFAAFAISDAFVKSLRGGLPAYEAVFFGAALGLSALPFIKGPGDRWRDVV
LAQRQWLWLVRAAASATGSIAAVVAFTALPMAEAFALIFLLPIFVTILSVLVLKEHVGWR
RWSAVVAGFAGVLVVLRPGFRVLGIGHLAAIVCGLSGAISMVALRLSGAHEKRVTLYGAG
VVGSMLVAGLLMLADFRWPSLAQWGLLAGYGLLAALAGVLLMLATQLAHANRVAPTQYSQ
MLWAIGFGYWLFGDRLDWPMLIGIVMILGAGLFTLVREEQKTRWWRRTRMM