Protein Info for OKGIIK_05680 in Rhodanobacter sp. FW510-T8

Name: moxR
Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF20030: bpMoxR" amino acids 15 to 194 (180 residues), 27.3 bits, see alignment E=5.3e-10 PF07726: AAA_3" amino acids 46 to 176 (131 residues), 210.6 bits, see alignment E=2e-66 PF07728: AAA_5" amino acids 46 to 174 (129 residues), 48.9 bits, see alignment E=2.1e-16 PF00004: AAA" amino acids 52 to 161 (110 residues), 26.6 bits, see alignment E=2.2e-09 PF17863: AAA_lid_2" amino acids 239 to 295 (57 residues), 60.9 bits, see alignment E=2.4e-20

Best Hits

Swiss-Prot: 47% identical to YEAC_BACSU: Uncharacterized protein YeaC (yeaC) from Bacillus subtilis (strain 168)

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 66% identity to xcv:XCV1134)

Predicted SEED Role

"FIG022979: MoxR-like ATPases"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>OKGIIK_05680 AAA family ATPase (Rhodanobacter sp. FW510-T8)
MSALTQPHDAPLQQRLEAAMAQVNRVLLGKPRQVKLAFTCLIAGGHLLLEDVPGVGKTTL
AHALAATFALEFQRVQFTSDLLPSDIIGVSVYERETGQFRFHPGPIFTGLLLADEINRAS
PKTQSALLEAMAESQVTVDGQTHALAQPFFVVATQNPLDLNGTFPLPDSQLDRFMLRLSL
DYPDAAAERALLTGSDRRDLLAQLVPQLDGSALLALQRQAQAITASSALLDYLQALLAAS
RRHADIRVGLSPRAGLALLGAARAWALLSGRGHVLPEDIQALFVPLAAHRLLPVRGANGD
TLARLLLAEVAVD