Protein Info for OKGIIK_05365 in Rhodanobacter sp. FW510-T8

Annotation: Fe3+-siderophore ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 258 to 288 (31 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details amino acids 330 to 349 (20 residues), see Phobius details PF01032: FecCD" amino acids 36 to 350 (315 residues), 279.9 bits, see alignment E=1.2e-87

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 52% identity to mea:Mex_1p4215)

Predicted SEED Role

"Vitamin B12 ABC transporter, permease component BtuC" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>OKGIIK_05365 Fe3+-siderophore ABC transporter permease (Rhodanobacter sp. FW510-T8)
MGMPTTSTAAPTVRTASPAHAGWPGYGILLLLSLAVLVLAMVSMGLGRYRLPIQTVIDVL
WSALANKASGYSPAIENVVLAVRLPRVLAAMLVGASLAGAGAAYQTLFRNPLASPAILGV
SSGAGFGAALAMLLGGGALAVQGFSFAGGICAVGTAIFIAGHLGKDSALVLVLAGLVVSA
LFQALTSATKYLADPLDTLPTIVFWLLGSLGRVTASDLYFAAPFSALGIVALFLLRWPTQ
VLEAGDDEARTLGVPVRWLRVMLIVAATLMTAAAVSISGIVGWIGLLVPHLGRLMIGPAY
ARLLPASILLGAGFLLLVDDLCRSAFATELPLGIVTAILGAPVFVIILARARRQ