Protein Info for OKGIIK_04365 in Rhodanobacter sp. FW510-T8

Annotation: EamA-like transporter family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 transmembrane" amino acids 66 to 87 (22 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 181 to 197 (17 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 236 to 261 (26 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details amino acids 296 to 316 (21 residues), see Phobius details amino acids 322 to 340 (19 residues), see Phobius details PF00892: EamA" amino acids 65 to 196 (132 residues), 66.7 bits, see alignment E=1.2e-22 amino acids 206 to 337 (132 residues), 44.5 bits, see alignment E=8.8e-16

Best Hits

KEGG orthology group: None (inferred from 56% identity to psu:Psesu_1237)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>OKGIIK_04365 EamA-like transporter family (Rhodanobacter sp. FW510-T8)
MVERRNRHRDAARALRFGGGSVRTPHAARKPRRKWGTMRASPSFPGKALDPTSASPPAST
PLPLRAVLLMLGSAGFFALMAVTIRFASAQLHPFQITFFRSTFGALFALPLLHVHGWQLL
HTPRFGFYVMRCVLGMGGMLAGFWAIVNLPLAEAVALSYSSPLFVTIGAVLFLGEVVRLR
RWSAVVAGFIGVLVIVRPGSDAFAAGSLVALLAAALTGAVTISIKSLTGSEPADRIVLLT
TLLWVPLWVPLSLPAALAVWQWPHANIWPWLVLSGALGTGGHYCWTRALRLADASLLAPF
SYLQLLIVAVLAWWIFGEGVDRYTAAGAAIIIGASLYIAHREHQLSRQRRQLPVASGEPA
G