Protein Info for OKGIIK_02250 in Rhodanobacter sp. FW510-T8

Name: rapZ
Annotation: RNase adapter RapZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF03668: RapZ-like_N" amino acids 17 to 170 (154 residues), 156.9 bits, see alignment E=3.7e-50 PF22740: PapZ_C" amino acids 181 to 300 (120 residues), 146.8 bits, see alignment E=3.3e-47

Best Hits

Swiss-Prot: 52% identical to Y1108_STRMK: Nucleotide-binding protein Smlt1108 (Smlt1108) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K06958, UPF0042 nucleotide-binding protein (inferred from 53% identity to psu:Psesu_1062)

Predicted SEED Role

"Hypothetical ATP-binding protein UPF0042, contains P-loop"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>OKGIIK_02250 RNase adapter RapZ (Rhodanobacter sp. FW510-T8)
MSDDFPSPNPRVDPREIHLIVLTGMSGGGKTVALRALEDLEFYCVDNLPSALLPQLVGAV
VEGSGSKHRRIAVGVDVRNRGADFAHMPTVLSELAAAGVQVHLIFLDCRDEVLMKRFSET
RRRHPLATRGLSLADAIAEERRLLRPLMAIAEKVIDSSELNVHQLRRLVATGYAQATEGL
TLMFQSFAFKRGLPLDADFVFDARCLPNPHWHAHLRPLSGKDKPVRDFLDAEPLVGEYFA
DTTRWLDAWLPRFEQDDRSYVTISIGCTGGRHRSVYLVEKLAAHYRARREGVLTFHRELE