Protein Info for OKGIIK_02210 in Rhodanobacter sp. FW510-T8

Name: lepB
Annotation: signal peptidase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF10502: Peptidase_S26" amino acids 14 to 203 (190 residues), 146 bits, see alignment E=5.5e-47 TIGR02227: signal peptidase I" amino acids 14 to 206 (193 residues), 150.2 bits, see alignment E=2.3e-48

Best Hits

KEGG orthology group: K03100, signal peptidase I [EC: 3.4.21.89] (inferred from 58% identity to bxe:Bxe_A2510)

Predicted SEED Role

"Signal peptidase I (EC 3.4.21.89)" in subsystem Signal peptidase (EC 3.4.21.89)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.89

Use Curated BLAST to search for 3.4.21.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>OKGIIK_02210 signal peptidase I (Rhodanobacter sp. FW510-T8)
MHAIARFLARNKGFITFMLCMIVFRSAVADWNVVPTGSMQPTIRIGDRILVDKLAYDVRL
PLTRVSLLHLADPQRGDIVVLDSRAANERLVKRVIGLPGDQVAMRGNVLFINGHTARYAT
DSYAGIHDDLRNPAHYEIERYGTMRHAIRLSDYRPSPASGFGPVQVPPGRYLLLGDDRDN
SMDSRYFGFFPRNEIVGRARHVVASLDPDHHYLPRGERFGAPLD