Protein Info for OKGIIK_00105 in Rhodanobacter sp. FW510-T8

Name: lipA
Annotation: lipoyl synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF16881: LIAS_N" amino acids 45 to 83 (39 residues), 32.3 bits, see alignment 1.2e-11 TIGR00510: lipoyl synthase" amino acids 45 to 328 (284 residues), 456.7 bits, see alignment E=1.8e-141 PF04055: Radical_SAM" amino acids 98 to 264 (167 residues), 97.3 bits, see alignment E=1.2e-31

Best Hits

Swiss-Prot: 73% identical to LIPA_XANOM: Lipoyl synthase (lipA) from Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 73% identity to xom:XOO_3730)

MetaCyc: 69% identical to lipoyl synthase (Escherichia coli K-12 substr. MG1655)
Lipoyl synthase. [EC: 2.8.1.8]

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.8

Use Curated BLAST to search for 2.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>OKGIIK_00105 lipoyl synthase (Rhodanobacter sp. FW510-T8)
MSETTVSSPKVIPISVVAGAPAAEKQLGNDKIALNRAGFDTSVPTLRKPSWIRVRLPQGN
AVQQLKARLRENSLVTVCEEASCPNIHECFSKGTATFMILGEVCTRRCSFCDVAHGRPVA
PDPLEPARLAETIRDMRLKYVVITSVDRDDLRDGGAEHFAACIRATRHASPSIRIEILTP
DFRGKGRMERALDVLKDFPPDVFNHNLETVPHLYREVRPGADYQWSLDLLKRFKVQHPEV
PTKSGIMLGLGETMEQVLETMRDLRDHDVEMITIGQYLQPTPHHHPVVRYWTPEEFDALR
AEGEAMGFHHVASGPLVRSSYHADLQAHAAGVTESA