Protein Info for OKFHMN_28690 in Escherichia coli ECRC100

Name: yciC
Annotation: envelope biogenesis factor ElyC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 83 to 107 (25 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 187 to 212 (26 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details PF06790: UPF0259" amino acids 1 to 244 (244 residues), 352.5 bits, see alignment E=7.3e-110

Best Hits

Swiss-Prot: 100% identical to YCIC_ECO57: UPF0259 membrane protein YciC (yciC) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b1255)

Predicted SEED Role

"Membrane protein YciC, linked to IspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>OKFHMN_28690 envelope biogenesis factor ElyC (Escherichia coli ECRC100)
MSITAQSVYRDTGNFFRNQFMTILLVSLLCAFITVVLGHVFSPSDAQLAQLNDGVPVSGS
SGLFDLVQNMSPEQQQILLQASAASTFSGLIGNAILAGGVILIIQLVSAGQRVSALRAIG
ASAPILPKLFILIFLTTLLVQIGIMLVVVPGIIMAILLALAPVMLVQDKMGVFASIRSSM
RLTWANMRLVAPAVLSWLLAKTLLLLFASSFAALTPEIGAVLANTLSNLISAILLIYLFR
LYMLIRQ