Protein Info for OKFHMN_28205 in Escherichia coli ECRC100

Name: minE
Annotation: cell division topological specificity factor MinE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 88 TIGR01215: cell division topological specificity factor MinE" amino acids 1 to 83 (83 residues), 124.3 bits, see alignment E=7.6e-41 PF03776: MinE" amino acids 14 to 82 (69 residues), 87.1 bits, see alignment E=3.1e-29

Best Hits

Swiss-Prot: 100% identical to MINE_ECOBW: Cell division topological specificity factor (minE) from Escherichia coli (strain K12 / MC4100 / BW2952)

KEGG orthology group: K03608, cell division topological specificity factor (inferred from 100% identity to eco:b1174)

Predicted SEED Role

"Cell division topological specificity factor MinE" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (88 amino acids)

>OKFHMN_28205 cell division topological specificity factor MinE (Escherichia coli ECRC100)
MALLDFFLSRKKNTANIAKERLQIIVAERRRSDAEPHYLPQLRKDILEVICKYVQIDPEM
VTVQLEQKDGDISILELNVTLPEAEELK