Protein Info for OKFHMN_27040 in Escherichia coli ECRC100

Name: ydiY
Annotation: Uncharacterized protein YdiY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF04338: DUF481" amino acids 48 to 251 (204 residues), 197.4 bits, see alignment E=1.5e-62

Best Hits

Swiss-Prot: 100% identical to YDIY_ECOLI: Uncharacterized protein YdiY (ydiY) from Escherichia coli (strain K12)

KEGG orthology group: K07283, putative salt-induced outer membrane protein (inferred from 100% identity to ebr:ECB_01691)

Predicted SEED Role

"Putative outer membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>OKFHMN_27040 Uncharacterized protein YdiY (Escherichia coli ECRC100)
MKLLKTVPAIVMLAGGMFASLNAAADDSVFTVMDDPASAKKPFEGNLNAGYLAQSGNTKS
SSLTADTTMTWYGQTTAWSLWGNASNTSSNDERSSEKYAAGGRSRFNLTDYDYLFGQASW
LTDRYNGYRERDVLTAGYGRQFLNGPVHSFRFEFGPGVRYDKYTDNASETQPLGYASGAY
AWQLTDNAKFTQGVSVFGAEDTTLNSESALNVAINEHFGLKVAYNVTWNSEPPESAPEHT
DRRTTLSLGYSM