Protein Info for OKFHMN_24390 in Escherichia coli ECRC100

Name: wcaL
Annotation: colanic acid biosynthesis glycosyltransferase WcaL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details TIGR04005: colanic acid biosynthesis glycosyltransferase WcaL" amino acids 1 to 406 (406 residues), 875 bits, see alignment E=3.1e-268 PF13439: Glyco_transf_4" amino acids 15 to 210 (196 residues), 29.3 bits, see alignment E=2.5e-10 PF20706: GT4-conflict" amino acids 169 to 390 (222 residues), 44.8 bits, see alignment E=2.6e-15 PF00534: Glycos_transf_1" amino acids 215 to 374 (160 residues), 136 bits, see alignment E=3e-43 PF13692: Glyco_trans_1_4" amino acids 224 to 366 (143 residues), 100.6 bits, see alignment E=2.8e-32 PF13524: Glyco_trans_1_2" amino acids 316 to 391 (76 residues), 25.3 bits, see alignment E=4.4e-09

Best Hits

Swiss-Prot: 99% identical to WCAL_ECOLI: Putative colanic acid biosynthesis glycosyltransferase WcaL (wcaL) from Escherichia coli (strain K12)

KEGG orthology group: K01043, [EC: 2.-.-.-] (inferred from 100% identity to ecf:ECH74115_2978)

Predicted SEED Role

"Colanic acid biosynthesis glycosyl transferase WcaL" in subsystem Colanic acid biosynthesis

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>OKFHMN_24390 colanic acid biosynthesis glycosyltransferase WcaL (Escherichia coli ECRC100)
MKVGFFLLKFPLSSETFVLNQITAFIDMGFEVEIVALQKGDTQNTHVAWTKYNLAARTRW
LQDEPTGKVAKLRHRASQTLRGIHRKNTWQALNLKRYGAESWNLILSAICGQVATPFRAD
VFIAHFGPAGVTAAKLRELGVIHGKIATIFHGIDISSREVLNHYTPEYQQLFRRGDLMLP
ISDLWAGRLQKMGCPREKIAVSRMGVDMTRFSPRPVKAPATPLEIISVARLTEKKGLHVA
IEACRQLKEQGVAFRYRILGIGPWERRLRTLIEQYQLEDVVEMPGFKPSHEVKAMLDDAD
VFLLPSVTGADGDMEGIPVALMEAMAVGIPVVSTLHSGIPELVEADKSGWLVPENDARAL
AQRLAAFSQLDTDELAPVVKRAREKVEHDFNQQVINRELASLLQAL