Protein Info for OKFHMN_23035 in Escherichia coli ECRC100

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details PF07690: MFS_1" amino acids 6 to 215 (210 residues), 75.7 bits, see alignment E=1.7e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to etw:ECSP_3121)

Predicted SEED Role

"Inner membrane transport protein YfaV"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>OKFHMN_23035 MFS transporter (Escherichia coli ECRC100)
MDLWGHPGWFWMFVIEGLLAVGAGVFTFFWLDDTPEQARFLSKLEKTLLINQLASEEQQK
VTSRLSDALRNGRVWQLAIIYLTIQVAVYGLIFFLPTQVAALLGTKVGFTASVVTAIPWV
AALFGTWLIPRYSDKTGERRNVAALTLLAAGIGIGLSGLLSPVLAIVALCVAAIGFIAVQ
PVFWTMPTQLLSGTALAAGIGFVNLLGAVGGFIAPILRVKAETLFASDAAGLLTLAAVAV
IGSLIIFTLRVNRTVAQTDVAHH