Protein Info for OKFHMN_22950 in Escherichia coli ECRC100

Name: menC
Annotation: o-succinylbenzoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21508: MenC_N
  • amino acids 1 to 94 (94 residues), 137 bits, E=1.9e-44
• TIGR01927: o-succinylbenzoate synthase
  • amino acids 7 to 306 (300 residues), 444.8 bits, E=8.2e-138
• PF13378: MR_MLE_C
  • amino acids 123 to 282 (160 residues), 61.2 bits, E=1.2e-20

Best Hits

Swiss-Prot: 100% identical to MENC_ECO5E: o-succinylbenzoate synthase (menC) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K02549, O-succinylbenzoate synthase [EC: 4.2.1.113] (inferred from 99% identity to eco:b2261)

MetaCyc: 99% identical to o-succinylbenzoate synthase (Escherichia coli K-12 substr. MG1655)
o-succinylbenzoate synthase. [EC: 4.2.1.113]

Predicted SEED Role

"O-succinylbenzoate synthase (EC 4.2.1.113)" (EC 4.2.1.113)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (9/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (7/7 steps found)
• superpathway of menaquinol-10 biosynthesis (9/10 steps found)
• superpathway of menaquinol-11 biosynthesis (9/10 steps found)
• superpathway of menaquinol-12 biosynthesis (9/10 steps found)
• superpathway of menaquinol-13 biosynthesis (9/10 steps found)
• superpathway of menaquinol-6 biosynthesis (9/10 steps found)
• superpathway of menaquinol-7 biosynthesis (9/10 steps found)
• superpathway of menaquinol-9 biosynthesis (9/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (8/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (8/9 steps found)
• superpathway of phylloquinol biosynthesis (7/15 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.113

Protein Sequence (320 amino acids)

>OKFHMN_22950 o-succinylbenzoate synthase (Escherichia coli ECRC100)
MRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCLREGEREGWGEISPLPGFSQETWEEAQ
SVLLAWVNNWLAGDCELPQMPSVAFGVSCALAELADTLPQAANYRTAPLCNGDPDDLILK
LADMPGEKVAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVNP
DYRHRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAFVAEEGVRAVVIKPTLTG
SLEKVREQVQAAHALGLTAVISSSIESSLGLTQLARIAAWLTPDTIPGLDTLDLMQAQQV
RRWPGSTLPVVEVDALERLL