Protein Info for OKFHMN_21790 in Escherichia coli ECRC100

Name: pdeF
Annotation: cyclic-guanylate-specific phosphodiesterase PdeF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 747 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 44 to 73 (30 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 126 to 149 (24 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 241 to 258 (18 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 297 to 317 (21 residues), see Phobius details PF05231: MASE1" amino acids 15 to 320 (306 residues), 237.8 bits, see alignment E=1.5e-74 PF00563: EAL" amino acids 498 to 730 (233 residues), 239.1 bits, see alignment E=4.4e-75

Best Hits

Swiss-Prot: 99% identical to PDEF_ECOLI: Cyclic di-GMP phosphodiesterase PdeF (pdeF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b2503)

MetaCyc: 99% identical to cyclic di-GMP phosphodiesterase PdeF (Escherichia coli K-12 substr. MG1655)
Cyclic-guanylate-specific phosphodiesterase. [EC: 3.1.4.52]

Predicted SEED Role

"Putative cytochrome C-type biogenesis protein" in subsystem Biogenesis of c-type cytochromes

Isozymes

Compare fitness of predicted isozymes for: 3.1.4.52

Use Curated BLAST to search for 3.1.4.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (747 amino acids)

>OKFHMN_21790 cyclic-guanylate-specific phosphodiesterase PdeF (Escherichia coli ECRC100)
MKLNATYIKIRDKWWGLPLFLPSLILPIFAHINTFAHISSGEVFLFYLPLALMISMMMFF
SWAALPGIALGIFVRKYAELGFYETLSLTANFIIIIILCWGGYRVFTPRRNNVSHGDTRL
ISQRIFWQIVFPATLFLILFQFAAFVGLLASRENLVGVMPFNLGTLINYQALLVGNLIGV
PLCYFIIRVVRNPFYLRSYYSQLKQQVDVKVTKKEFALWLLALGALLLLLCMPLNEKSTI
FSTNYTLSLLLPLMMWGAMRYGYKLISLLWAVVLMISIHSYQNYIPIYPGYTTQLTITSS
SYLVFSFIVNYMAVLATRQRTVVRRIQRLAYVDPVVHLPNVRALNRALRDAPWSALCYLR
IPGMEMLVKNYGIMLRIQYKQKLSHWLSPLLEPGEDVYQLSGNDLALRLNTESHQERITA
LDSHLKQFRFFWDGMPMQPQIGVSYCYVRSPVNHIYLLLGELNTVAELSIVTNAPENMQR
RGAMYLQRELKDKVAMMNRLQQALEHNHFFLMAQPITGMRGDVYHEILLRMKGENDELIG
PDSFLPVAHEFGLSSSIDMWVIEHTLQFMAENRAKMPAHRFAINLSPTSVCQARFPVEVS
QLLDKYQIEAWQLIFEVTESNALTNVKQAQITLQHLQELGCQIAIDDFGTGYASYARLKN
VNADLLKIDGSFIRNIVSNSLDYQIVASICHLARMKKMRVVAEYVENEEIREAVLSLGID
YMQGYLIGKPQPLIDTLNEIEPIRESA