Protein Info for OKFHMN_21695 in Escherichia coli ECRC100

Name: dmsC
Annotation: dimethyl sulfoxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details PF04976: DmsC" amino acids 1 to 270 (270 residues), 84.1 bits, see alignment E=5.9e-28

Best Hits

KEGG orthology group: K07308, anaerobic dimethyl sulfoxide reductase subunit C (DMSO reductase anchor subunit) (inferred from 100% identity to eok:G2583_3045)

Predicted SEED Role

"Anaerobic dimethyl sulfoxide reductase chain C (EC 1.8.5.3)" (EC 1.8.5.3)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.8.5.3

Use Curated BLAST to search for 1.8.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>OKFHMN_21695 dimethyl sulfoxide reductase (Escherichia coli ECRC100)
MHELPLMAFTLLLQASVGMTLWLAFLHRHILITSSARPVMRPPLLLAFLAGAVGLLISTL
HLGYPLNAMHALSHFSSSWLSREIIFGALYLALLGLSTLLVMLRKGGWQLLLMLAAVVGI
VDVFCMAQVYIHTSIITWQHYNTLIMFLGTVGILGSALVAVFRISGILPQIDALRNGCVL
VIALLVLLRLLVQPLWIGDLTANAMQIATLPHAPLAMLGQLKPILTLSWGISVIGMMFFA
VGGCKKNIPAALFGSVMLVGSEVMLRFVFFSIG