Protein Info for OKFHMN_21550 in Escherichia coli ECRC100

Name: yphB
Annotation: Uncharacterized protein YphB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF01263: Aldose_epim" amino acids 3 to 285 (283 residues), 183.3 bits, see alignment E=3.7e-58

Best Hits

Swiss-Prot: 99% identical to YPHB_ECOLI: Uncharacterized protein YphB (yphB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b2544)

Predicted SEED Role

"Aldose 1-epimerase family protein YphB" in subsystem Unknown sugar utilization (cluster yphABCDEFG)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>OKFHMN_21550 Uncharacterized protein YphB (Escherichia coli ECRC100)
MTIYTLSHGSLKLGVSDQGGVIEGFWRDTTPLLRPGKKSGVATDASCFPLVPFANRVSGN
RFVWQGREYQLQPNVEWDAHYLHGDGWLGEWQCVSHSDDSLCLVYEHRSGVYHYRVSQAF
HLTADTLTVTLSVTNQGAETLPFGTGWHPYFPLSPQTRIQAQASGYWLEREQWLAGEFCE
QLPQELDFNQLAPLPRQWVNNGFAGWNGQARIEQPQEGYAIIIETTPPAPCYFIFVSDPA
FDKGYAFDFFCLEPMSHAPDDHHRPEGGDLIALAPGESTTSEMSLRVEWL