Protein Info for OKFHMN_20835 in Escherichia coli ECRC100

Annotation: Ribonucleoside-diphosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 253 to 271 (19 residues), see Phobius details PF08343: RNR_N" amino acids 16 to 97 (82 residues), 101.8 bits, see alignment E=2.5e-33 PF00317: Ribonuc_red_lgN" amino acids 99 to 171 (73 residues), 63.2 bits, see alignment E=3e-21 PF02867: Ribonuc_red_lgC" amino acids 176 to 254 (79 residues), 87.8 bits, see alignment E=9.9e-29

Best Hits

Predicted SEED Role

"Ribonucleotide reductase of class Ib (aerobic), alpha subunit (EC 1.17.4.1)" in subsystem Ribonucleotide reduction (EC 1.17.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.4.1

Use Curated BLAST to search for 1.17.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>OKFHMN_20835 Ribonucleoside-diphosphate reductase (Escherichia coli ECRC100)
LATTTAECLTQKTMDYHALNAMLNLYDSAGRIQFDKDRQAVDAFMATHVRPNSVTFSSQQ
QRLNWLVNEGYYDESVLNRYSRDFVITLFAHAHTSGFRFQTFLGAWKFYTSYTLKTFDGK
RYLEDFADRVTMVALTLAQGDETLALQLTDEMLSGRFQPATPTFLNCGKQQRGELVSCFL
LRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLED
AFSYANQLGARQGLVQSIYMLIIPIFCVFSTRNGKMPTKKSALKHCRLAW