Protein Info for OKFHMN_20160 in Escherichia coli ECRC100

Name: fucA
Annotation: L-fuculose-phosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01086: L-fuculose phosphate aldolase
  • amino acids 2 to 215 (214 residues), 443.9 bits, E=4.9e-138
• PF00596: Aldolase_II
  • amino acids 9 to 182 (174 residues), 186.6 bits, E=2.1e-59

Best Hits

Swiss-Prot: 100% identical to FUCA_ECO57: L-fuculose phosphate aldolase (fucA) from Escherichia coli O157:H7

KEGG orthology group: K01628, L-fuculose-phosphate aldolase [EC: 4.1.2.17] (inferred from 100% identity to eco:b2800)

MetaCyc: 100% identical to L-fuculose-phosphate aldolase (Escherichia coli K-12 substr. MG1655)
L-fuculose-phosphate aldolase. [EC: 4.1.2.17]; 4.1.2.17 [EC: 4.1.2.17]

Predicted SEED Role

"L-fuculose phosphate aldolase (EC 4.1.2.17)" in subsystem L-fucose utilization (EC 4.1.2.17)

MetaCyc Pathways

• superpathway of fucose and rhamnose degradation (12/12 steps found)
• D-arabinose degradation II (4/4 steps found)
• L-fucose degradation I (4/4 steps found)
• lactate biosynthesis (archaea) (3/5 steps found)
• nucleoside and nucleotide degradation (halobacteria) (3/6 steps found)
• superpathway of pentose and pentitol degradation (15/42 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.17

Protein Sequence (215 amino acids)

>OKFHMN_20160 L-fuculose-phosphate aldolase (Escherichia coli ECRC100)
MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDG
NGKHEEGKLPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
NSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVEVLAQL
YLTTLAITDPVPVLSDEEIAVVLEKFKTYGLRIEE