Protein Info for OKFHMN_19385 in Escherichia coli ECRC100

Name: epd
Annotation: erythrose-4-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF00044: Gp_dh_N" amino acids 3 to 104 (102 residues), 124.1 bits, see alignment E=2.5e-40 TIGR01532: erythrose-4-phosphate dehydrogenase" amino acids 4 to 328 (325 residues), 659 bits, see alignment E=6.7e-203 PF02800: Gp_dh_C" amino acids 160 to 316 (157 residues), 188.5 bits, see alignment E=6.1e-60

Best Hits

Swiss-Prot: 100% identical to E4PD_ECOLC: D-erythrose-4-phosphate dehydrogenase (epd) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K03472, D-erythrose 4-phosphate dehydrogenase [EC: 1.2.1.72] (inferred from 100% identity to eco:b2927)

MetaCyc: 100% identical to D-erythrose-4-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Erythrose-4-phosphate dehydrogenase. [EC: 1.2.1.72]

Predicted SEED Role

"D-erythrose-4-phosphate dehydrogenase (EC 1.2.1.72)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.2.1.72)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>OKFHMN_19385 erythrose-4-phosphate dehydrogenase (Escherichia coli ECRC100)
MTVRVAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFAWE
VRQERDQLFVGDDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKV
LFSHPGSNDLDATVVYGVNQDQLRAEHRIVSNASCTTNCIIPVIKLLDDAYGIESGTVTT
IHSAMHDQQVIDAYHPDLRRTRAASQSIIPVDTKLAAGITRFFPQFNDRFEAIAVRVPTI
NVTAIDLSVTVKKPVKANEVNLLLQKAAQGAFHGIVDYTELPLVSVDFNHDPHSAIVDGT
QTRVSGAHLIKTLVWCDNEWGFANRMLDTTLAMATVAFR