Protein Info for OKFHMN_18640 in Escherichia coli ECRC100

Name: nfeF
Annotation: NADPH-dependent ferric chelate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF08021: FAD_binding_9" amino acids 21 to 132 (112 residues), 123 bits, see alignment E=8.4e-40 PF04954: SIP" amino acids 141 to 253 (113 residues), 88.4 bits, see alignment E=5.2e-29

Best Hits

Swiss-Prot: 100% identical to YQJH_ECOLI: NADPH-dependent ferric-chelate reductase (yqjH) from Escherichia coli (strain K12)

KEGG orthology group: K07229, (no description) (inferred from 100% identity to eco:b3070)

MetaCyc: 100% identical to NADPH-dependent ferric-chelate reductase (Escherichia coli K-12 substr. MG1655)
RXN0-6555 [EC: 1.16.1.9]; 1.16.1.9 [EC: 1.16.1.9]; 1.16.1.9 [EC: 1.16.1.9]

Predicted SEED Role

"iron-chelator utilization protein" in subsystem Ton and Tol transport systems

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.16.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>OKFHMN_18640 NADPH-dependent ferric chelate reductase (Escherichia coli ECRC100)
MNNSPRYPQRVRNDLRFRELTVLRVERISAGFQRIVLGGEALDGFTSRGFDDHSKLFFPQ
PDAHFVPPTVTEEGIVWPEGPRPPSRDYTPLYDELRHELAIDFFIHDGGVASGWAMQAQP
GDKLTVAGPRGSLVVPEDYAYQLYVCDESGMPALRRRLETLSKLAVKPQVSALVSVRDNA
CQDYLAHLDGFNIEWLAHDEQAVDARLAQMQIPADDYFIWITGEGKVVKNLSRRFEAEQY
DPQRVRAAAYWHAK